PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA12g17430
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family BES1
Protein Properties Length: 324aa    MW: 35007.1 Da    PI: 8.877
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA12g17430genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822213.55.4e-66271592135
      DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeaeaagssasaspesslqsslks 100
                 +++rkp+w+ErEnn+rRERrRRa+aakiy+GLRaqGny+lpk++DnneVlkALc eAGw+ve DGttyrkg+kp+  +e++g+sa+++p+ss + s+ s
  CA12g17430  27 TGRRKPSWRERENNRRRERRRRAVAAKIYSGLRAQGNYNLPKHCDNNEVLKALCVEAGWIVESDGTTYRKGCKPT-PMEIGGTSANITPSSSRHASPPS 124
                 789************************************************************************.*********************** PP

      DUF822 101 salaspvesysaspksssfpspssldsislasaas 135
                 s++asp++sy++sp+sssfps s +d ++++++  
  CA12g17430 125 SYFASPIPSYQPSPTSSSFPSLSLADANMSSHPYA 159
                 *************************9998876633 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056877.2E-6028153IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009742Biological Processbrassinosteroid mediated signaling pathway
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MTWEAGGSTT STGAGGNGVA GVLPESTGRR KPSWRERENN RRRERRRRAV AAKIYSGLRA  60
QGNYNLPKHC DNNEVLKALC VEAGWIVESD GTTYRKGCKP TPMEIGGTSA NITPSSSRHA  120
SPPSSYFASP IPSYQPSPTS SSFPSLSLAD ANMSSHPYAF LHNVIPSSLP PLRVSNSAPV  180
TPPLSSPTRH PKPTFNLETL AKESMFALNI PFFAASAPAS PTRGQRFTPP TIPECDESDS  240
STIDSGQWIN FQKYATNVPA SPTFNLVKPV PQPLRPNDMI TDKGKSIDFD FENVSVKAWE  300
GERIHDVGFE DLELTLGSGS ARM*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
12847RRKPSWRERENNRRRERRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00237DAPTransfer from AT1G75080Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3959010.0AF395901.1 Lycopersicon esculentum mature anther-specific protein LAT61 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016551768.10.0PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like
SwissprotQ8S3071e-120BZR1_ARATH; Protein BRASSINAZOLE-RESISTANT 1
TrEMBLM1B8X31e-178M1B8X3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000398791e-178(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28122454
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75080.21e-101BES1 family protein